PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100070940021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 332aa    MW: 36370.3 Da    PI: 6.8991
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100070940021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27117171156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k++++WtpeLH+rFv aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  Ote100070940021|100070940021 117 KAKVEWTPELHRRFVAAVEQL-GIDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 171
                                   6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.877114173IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-27115174IPR009057Homeodomain-like
SuperFamilySSF466894.84E-18115174IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26117171IPR006447Myb domain, plants
PfamPF002491.3E-6119169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MLTVKSERNE RQSEMQRSVE ESEFINGGDL LDSIDFDDLF AGIGDGDVLP DLEMDQEILA  60
EFSGSEIEKN HVKSENASPD SVSGSGQGPE PESKPATKNP ASKETERIGK NPAGKKKAKV  120
EWTPELHRRF VAAVEQLGID KAVPSRILEI MGIDCLTRHN IASHLQKYRS HRKHLQAREA  180
EAANWSRRRQ IYGIAAAGVA AAAIGFPPVV PHFRPLHVWG HPSVDQSLMH MWPKHIAPPP  240
PLVDLSHHQY VSPVPGTLRF PPTRLAPPQP SNAQTLSPTP SNVHPSNESI DAAIGDVIKK  300
PWLPLPLGLK PPSMEGVIAE LQRQGVSKIP PP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16114169257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260326.11e-109PREDICTED: probable transcription factor GLK1
SwissprotQ9SIV34e-76GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A068V5131e-109A0A068V513_COFCA; Uncharacterized protein
STRINGVIT_12s0028g03100.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356